Breast Milk May Safeguard Against Deadly Newborn Disease

 

Maple Syrup Urine Disease (MSUD)

Video taken from the channel: Nutricia Metabolics


 

Human Milk and COVID-19 with Lars Bode, PhD

Video taken from the channel: University of California Television (UCTV)


 

The Most Disturbing Parasites Found Inside Humans! | Monsters Inside Me

Video taken from the channel: Discovery UK


 

Smoking Causes Cancer, Heart Disease, Emphysema

Video taken from the channel: Nucleus Medical Media


 

Bad Science: Breast Milk and Formula

Video taken from the channel: SciShow


 

Protein in Mothers’ Milk May Protect Babies Against HIV

Video taken from the channel: VOA Learning English


 

The Biology of Breast Milk

Video taken from the channel: FoundMyFitness


TUESDAY, Sept. 9, 2014 (HealthDay News) A protein in breast milk that is not found in infant formula may protect newborns from a potentially deadly gastrointestinal disease, a. TUESDAY, Sept. 9, 2014 (HealthDay News) A protein in breast milk that is not found in infant formula may protect newborns from a potentially deadly gastrointestinal disease, a new study suggests.

Breast milk contains the protein neuregulin-4 (NRG4), which can help prevent the intestinal damage caused by necrotizing enterocolitis (NEC), the researchers found. TUESDAY, Sept. 9, 2014 (HealthDay News) A protein in breast milk that is not found in infant formula may protect newborns from a potentially deadly gastrointestinal disease, a new study suggests. Breast milk contains the protein neuregulin-4 (NRG4), which can help prevent the intestinal damage caused by necrotizing enterocolitis (NEC), the researchers found.

Travel nursing professionals are well aware that breast milk is a balanced form of nutrition for infants, with plenty of protein, carbs and vitamins and minerals that allow babies to grow strong and healthy. Researchers have found in newborn mice that a component of breast milk may help protect premature babies from developing life-threatening sepsis. Breast milk sugar may protect babies against deadly infection by Imperial College London A type of sugar found naturally in some women’s breast milk may protect new born babies from infection. A type of sugar found naturally in some women’s breast milk may protect newborn babies from infection with a potentially life threatening bacterium called. Breast milk sugar may protect babies against deadly infection A type of sugar found naturally in some women’s breast milk may protect new born babies from infection with a potentially life threatening bacterium called Group B streptococcus, according.

In fact, preemies given breast milk as babies are less likely to have high blood pressure by the time they’re teenagers. Researchers have also found that breastfeeding protects against Crohn’s disease and ulcerative colitis. Breastfeeding may lower your baby’s risk of developing allergies and eczema.

Breast Milk Sugar May Protect Babies Against Deadly Infection A type of sugar found naturally in some women’s breast milk may protect newborn babies from infection with a potentially life threatening bacterium called Group B streptococcus, according to a.

List of related literature:

It is, moreover, the major immunoglobulin found in the colostrum of milk in nursing mothers, and it may provide the neonate with a major source of intestinal protection against pathogens during the first few weeks after birth.

“Immunology: A Short Course” by Richard Coico, Geoffrey Sunshine
from Immunology: A Short Course
by Richard Coico, Geoffrey Sunshine
Wiley, 2015

IgA, found in colostrum, is thought to contribute to passive immunity for breastfed newborns and may also play an important role in the development of the neonate’s immune system (Brandtzaeg, 2010).

“AWHONN's Perinatal Nursing” by Kathleen R. Simpson
from AWHONN’s Perinatal Nursing
by Kathleen R. Simpson
Wolters Kluwer Health, 2013

Human milk may protect against the development of allergies—both by reducing exposure of the infant to bovine milk allergens and by supplying secretory IgA, which reduces intestinal absorption of potentially antigenic proteins before gut closure at 6 to 9 months.

“Maternal, Fetal, & Neonatal Physiology: A Clinical Perspective” by Susan Tucker Blackburn
from Maternal, Fetal, & Neonatal Physiology: A Clinical Perspective
by Susan Tucker Blackburn
Saunders Elsevier, 2007

Anti-inflammatory Agents Although a direct anti-inflammatory effect of human milk has not been shown in vivo, numerous clinical observations suggest that breast-feeding protects the recipient infant from injury to the intestinal or respiratory mucosa [211,212].

“Infectious Diseases of the Fetus and Newborn E-Book” by Jack S. Remington, Christopher B. Wilson, Victor Nizet, Jerome O. Klein, Yvonne Maldonado
from Infectious Diseases of the Fetus and Newborn E-Book
by Jack S. Remington, Christopher B. Wilson, et. al.
Elsevier Health Sciences, 2010

Maternal milk protects infants against bronchiolitis during the first year of life.

“Counseling the Nursing Mother” by Judith Lauwers, Anna Swisher
from Counseling the Nursing Mother
by Judith Lauwers, Anna Swisher
Jones & Bartlett Learning, 2015

Antibodies in breast milk may protect the nursing newborn against these infectious disease agents.

“Understanding Pathophysiology 3e Australia New Zealand” by Judy Craft, Christopher Gordon, Sue E. Huether, Kathryn L. McCance, Valentina L. Brashers
from Understanding Pathophysiology 3e Australia New Zealand
by Judy Craft, Christopher Gordon, et. al.
Elsevier Health Sciences Division, 2018

Newburg DS, Ruiz-Palacious GM, Morrow AL: Human milk glycans protect infants against enteric pathogens.

“Obstetrics: Normal and Problem Pregnancies E-Book” by Steven G. Gabbe, Jennifer R. Niebyl, Henry L Galan, Eric R. M. Jauniaux, Mark B Landon, Joe Leigh Simpson, Deborah A Driscoll
from Obstetrics: Normal and Problem Pregnancies E-Book
by Steven G. Gabbe, Jennifer R. Niebyl, et. al.
Elsevier Health Sciences, 2016

Antibodies in the mother’s milk are highly targeted against infectious agents in the mother’s environment, those to which the infant is likely to be exposed shortly after birth (Brandtzaeg, 2007).

“Counseling the Nursing Mother” by Judith Lauwers, Anna Swisher
from Counseling the Nursing Mother
by Judith Lauwers, Anna Swisher
Jones & Bartlett Learning, 2010

Maternal antibodies in breastmilk protect the child from enterovirus infections.

“Breastfeeding Management for the Clinician” by Marsha Walker
from Breastfeeding Management for the Clinician
by Marsha Walker
Jones & Bartlett Learning, 2016

Preterm infants fed breast milk have lower risks of infection and NEC, learn to nipple feed better, have higher cognitive scores, and may have a lower risk of chronic gastrointestinal diseases and allergies (AAP, 2006; Mizuno et al., 2002; Mortensen et al., 2002).

“Preterm Birth: Causes, Consequences, and Prevention” by Institute of Medicine, Board on Health Sciences Policy, Committee on Understanding Premature Birth and Assuring Healthy Outcomes, Adrienne Stith Butler, Richard E. Behrman
from Preterm Birth: Causes, Consequences, and Prevention
by Institute of Medicine, Board on Health Sciences Policy, et. al.
National Academies Press, 2007

Oktay Kutluk

Kutluk Oktay, MD, FACOG is one of the world's foremost experts in fertility preservation as well as ovarian stimulation and in vitro fertilization for infertility treatments. He developed and performed the world's first ovarian transplantation procedures as well as pioneered new ovarian stimulation protocols for embryo and oocyte freezing for breast and endometrial cancer patients.

Mail: [email protected]
Telephone: +1 (877) 492-3666

Biography: https://medicine.yale.edu/profile/kutluk_oktay/
Bibliography: oktay_bibliography

View all posts

120 comments

Your email address will not be published. Required fields are marked *

  • My grandpa keeps smoking im still wishing that he’s not getting cancer i hope he will stop.. Also my grandma smokes too and i hope they stop it..

  • Great video. One aspect was missing. Anticancer agents such as alphalacubim+oleic acid in child stomach low ph creates anti cancer activity shown i 40 diff cancer models. See hamletpharma.com Lund Sweden

  • Breast milk is good stuff. I tasted it when the baby was born. Why do we like cow’s milk, but find milk from a human revolting? My mother didn’t breastfeed me but a week, unfortunately.

  • You’re my favorite scientist! ❤️ You Dr. Rhonda! Can’t wait until I can introduce your work to my niece! Please appear on the JRE again when you can ������

  • Weird idea, but would HMOs have any application to adults? For example those who have a compromised guy microbiome for whatever reason? Seems like it would surely be a solution

  • Women’s brain aging: Effects of sex‐hormone exposure, pregnancies, and genetic risk for Alzheimer’s disease.
    https://onlinelibrary.wiley.com/doi/full/10.1002/hbm.25180

  • I bet there is a biological reason vitamin K is low in new born infants, and breast milk, and the recommendation by the academy of pediatrics to inject it at birth is likely more harmful than helpful, especially factoring in any excipients in that injection. Kind of like the counter intuitive assumption around iron.

  • Wow what a timing. We just welcomed our little one last week and have been battling between formula and breastmilk. Thanks for the video

  • if you’re a stupid person, you probably watched < the first minute and assumed the video claims formula is better than breast milk.
    the video says breast milk is best, except when it’s not. we don’t need parent-shaming out of ignorance. don’t be that person.

  • Best time of my life, I finally had decent size breasts & a reason to have them out in public! Was a bit ahead of my time in 1982.
    FREETHETATAS

  • My mother breastfed my sister but not me yet am smarter. Rhonda;

    1) do you still breastfeed your child? If not, how long did you do it?
    2) Are breastfed babies/ children at risk of developing an autoimmune disease or no correlation?

    Thanks ��

  • It’s great seeing the biology of human breast milk. I wonder if brain development etc are also influenced by the social implications of breastfeeding.

  • Hmmm the HMO’s are fascinating but what if it’s a byproduct of the organisms already exisisting in the mothers gut? In other words similar to the parasites or fungi that cause the host to say die in a certain position that benefits proliferation of the fungi? Maybe in HMO’s case the gut bacteria of the mother are causing the mother to produce the oligosaccharides to ensure species survival?

  • I used to work with mothers and infants. One of the infants couldn’t keep ANYTHING down, not formula or breast milk. He started to look really emaciated. She tried very thin oatmeal and that finally worked! #FedIsFundamental and he ended up thriving. I actually think formula is extremely scary with its corn syrup (gmo) and soy (gmo) and plant oils (inflammatory). I think we should have much better alternatives for moms who need to rely on it.

  • this is amazing! I’m on my first trimester with my first (if hopefully everything goes OK) and for some reason the birth doesn’t bother me at all, but breastfeeding does! So I love having such detailed, in-depth scientific information about how vital it is:)

  • I’ve been following your work for years, and I’m a big fan. Your smoothies have impaced my life, microbiome, and definitely the quality of the milk l produce.
    You are changing peoples life in the most beautiful way, thank you so much.

  • What do you think about eating based on genetic testing? Just had mine done and it says the perfect macro ratio for me is 52-59 percent carbs 25-30 percent fat and 25-30 percent protein. That seems kinda high for carbs

  • The human body is a marvel of creation. Sadly, western mainstream medicine continues to pass the idea that pharma or doctors know best. Just like the K1 vit. If there is almost none in mothers milk…..why give a shot to the infant???? Human arrogance. Awesome video.

  • My mom didn’t have milk and the deranged doctors told her formula is horrible and that she should wait for her milk to come however long so I spent 1st 3 days of my life on chamomile tea… Yeah, end of 80s in Europe, doc should’ve known better. Thankfully I ate formula after that and have 0 health issues. So don’t fret, other factors are way more important, like playing in dirt

  • I didn’t produce enough milk to feed my first child solely on beast milk, and eventually went to straight formula at 3 months. My second child wasn’t breastfed at all. Both were born visa cesarean as well. I’m afraid for their wellbeing and their future development. What can I do to help them now!?

  • This���� currently still breastfeeding my 9 month old and this made me feel SO good about it. It definitely is the hardest thing I’ve ever done but SO worth it����

  • Who the actual F would give this video a thumbs down? Infant formula makers? Born in the sixties to a Doctor following the science at the time. Screwed from the get go. Formula fed. Sigh…

  • I knew a mother who hadn’t breast fed her child due to her smoking. The baby was commonly sick and had at least one round of antibiotics. Looking at the video it seems the cons of cigarette milk seem more trivial than the cons of not breastfeeding, which I suspected.

  • My daughter had problems digesting breast milk. She looked very healthy and grew quickly, but she would have at least 10 rounds of explosive diarrhea per day and also lots of reflux/spit up and she barely slept. At around 5 months she was spending at least 12 hours a day feeding since so much was being lost; I got no sleep at all. At 5 1/2 months I had to switch her to formula; she immediately started having one normal bowel movement per day, started sleeping through the night and ceased spitting up. We are both carriers for medium acyl-CoA dehydrogenase deficiency; her infant screening for fatty acid oxidation disorders was normal, however. I have doubts about whether the newborn FAOD screening test is really a good indicator of all possible issues with fatty acid oxidation since some cell types are going to be more vulnerable than others to metabolic disturbance; there could be problems in some cells/tissues without what is considered to be clinically significant alteration of the acylcarnitine profile. I am symptomatic for MCAD, but the hypoglycemia attacks did not start until I was in my late teens. I regret not giving her solid food before weaning, since as pointed out in the video, breastfeeding when introducing wheat lessens the chance of developing Ceilac Disease. She was diagnosed with Celiac at 17 years.

  • The company bioMilq is making human breast milk in the lab.
    I wonder how the human race will change when we shift from cows milk for everything to human milk.
    https://www.biomilq.com/

  • Odd question I know. But if Breast milk is a primary method of infant Immune health, which transfers Immunoglobins to the infant. Wouldn’t infected and recovered and or normal breast milk(colostrum) from donors offer some degree of protection to the immunocompromised or sick patients with COVID.

  • You have been a household name in my immediate and extended family for years now. Thanks Dr. Rhonda for all you do! P.S. I have a 9 day old right now…so we are in the middle of figuring out how milk works! This is really helpful

  • I literally never drank breast milk because my mum didn’t love me enough. That probably the reason why I suffer with autism and severe paranoia.

  • Humans may have the most complex breast milk of all mammals. Human breast milk also helps lay the foundation for the new baby’s immune system. After birth, milk is rich in antibodies and molecules that slow the growth of harmful bacteria and coordinate white blood cell activity��

  • Thank you for explaining what many of us know in our hearts and souls. My son never had ear infections like other babies. It’s so sad how society has twisted common sense and nature.

  • Thank you so much for posting this amazing information, breastfeeding isn’t always easy for mums to master, but total worth the struggle and pain.

  • My younger sister ate so much when she was born that at 2 weeks my parents were having to feed her formula with mashed up soggy corn flakes just to keep her full for a minute.

  • I am super happy that he ended with “Formula is fine”. And not with a ringing endorsement of either. Of course modern formula isn’t going to harm your baby, especially with all the regulations in most countries. I think there is something to be said about the bonding that occurs though when breast feeding. To me, it makes sense to breast feed if you can just for that factor alone. Of course, there is a small percentage of women that can’t for various reasons. To those that don’t produce enough, some of them can produce more by changing their diet, etc. So, there are options out there for everyone really.:)

  • Skillshare is offering SciShow viewers two months of unlimited access to Skillshare for free! Try it here: https://skl.sh/scishow-15

  • Not true! The more you breastfeed the more milk you have!!! It’s a simple Demand-Supply relationship. If you feed your baby formula additionally, they’ll drink less of your milk, so your body will produce less milk. So if you want to breastfeed, don’t give formula (or only minimum very rarely) But if you choose formula for whatever reason, no judgement here, do what’s best in your opinion:))
    I’m just giving a tip to those who want to breastfeed (like I did, and I was given this valuable tip when I was a young mommy).

  • I guess that the symbolism here is that;
    Taking God away from humans is like switching a child from breast feeding to powdered milk.

  • This program kind of works with one’s brain chemistry to change it like you’ve never smoked before, kills your urge to even want a cigarette coulc.it/quitsmoke. I have never had such feelings before.

  • I understand the motivation behind this video but that was sloppy. Your bar for breastmilk being beneficial was way higher than your bar for formula being fine (repeatable well validated studies vs a single study and comparison to history). You should be as rigorous with research on both sides. Also fell into the framing trap of evaluating breastmilk as an intervention and not as the biological norm.

  • You didn’t mention the bond that increases between mother and baby because of breastfeeding. Babies who breastfeed are also held more than formula counterparts. Babies looooove the breast. Mine literally gets excited when I nurse him to sleep. The bond is priceless and I think it will help them develop emotional intelligence in future.

  • As a parent, I’m so happy for the family of the teenage boy who had that scary brain parasite. My heart is so happy he pulled thru.

  • Dude if I smoke and inhale nicotine it spreads in brain just to feel normal but carbon monoxide and nitrogen oxide and nicotine it damages my walls of artery and causes my red blood cells to get out of artery. And causes: heart disease, heart attack, stroke, lung cancer, death, emphysema.
    It gives me leucemia blood cancer.

  • Thank you for this video! My baby has an aggressive appetite. He only lost 4% of his body weight in the first week of life instead of the usual 10% and he gained it back plus an extra pound by his third week of life which his pediatrician was very impressed by. My right breast has stopped producing milk and the lactation consultants I’ve seen (plus my OBGYB) don’t know why. Lastly, my son was diagnosed with dysphasia with laryngeal penetration. He quite literally inhales his food and therefore needs to be on thickened liquids to feed safely. This means I can no longer nurse my baby and I have to thicken his food. The thickener needs to be added to a liquid at 100 degrees to mix properly, sit for at least five minutes to fully incorporate and is only stable in a breast milk bottle for 3 hours after mixing. Prepping a breast milk bottle can take up to 25 minutes and I can’t leave it out for up to six hours like a normal breast milk bottle if he doesn’t finish what I am able to produce. I can’t prep bottles ahead of time because it’s not recommended to reheat breast milk. Plus all that time spent pumping, prepping and then finally feeding my baby is extremely time consuming so we’ve resorted to formula for half of my son’s feeds. My husband and I formula feed at night, breast feed during the day and supplement with formula when he’s still hungry after a breast milk bottle. I’m constantly chastised by family and friends for not exclusively breastfeeding my baby and random people seem very entitled to give me their two cents on the topic, too. It’s extremely frustrating because I feel like I shouldn’t have to explain our circumstances to people and even when I take the time to do so, people still have this disapproving attitude to them.

  • I don’t wanna be THAT person, but I’m going to be THAT person anyways and say: parents that breastfeed???? As far as I know, only MOTHERS have the physical ability to breastfeed ��

  • In this cold cold world we black men live in, my heart goes out for little James. I’m so happy he made a complete recovery ������������‍♀️

  • Nice yesterday I got bitten by 3 mosquitoes and it was itchy af.. and now YouTube recommends me this video lmao I’m scared I might have worm larvas inside me now

  • The primary risks of tobacco usage include many forms of cancer, particularly lung cancer, kidney cancer, cancer of the larynx and head and neck, bladder cancer, cancer of the esophagus, cancer of the pancreas and stomach cancer. https://www.youtube.com/watch?v=q5-sRVLHhnE

  • breastfeeding exclusive for the first [6 monthes].. what is the wrong if still breastfeeding exclusive for the 8 monthes or one year? Why???

  • from what ive seen, “breast is best” is used almost exclusively to shame mothers who for whatever reason cant breastfeed. my mom got it a lot, even though she didnt breastfeed me because she just couldnt produce enough milk. she switched me to formula because she would nurse me for hours and i was still starving, yet other mothers (and of course a quite frankly ridiculous amount of men) who assumed they knew what was best for both of us shamed her for not breastfeeding me.

  • Just came back from a woman who was quite happy to let her baby starve for a few days until her milk came through more plentiful.
    When I told her the dangers of this she shrugged and told me; “It’s natural for this to happen, we’ve survived thousands of years doing it this way and so will my baby”.
    I don’t know what’s happened to the human population, but I’m going to quit my job (nursing) as I can no longer tolerate the lack of common sense.
    I give it less than 5 days before that baby is in intensive care, and guess who’s going to have to pull miracles out of our arses to save the little tyke? No mention of medical assistance being un-natural then…oh no of course not!

  • For cure of any disease, genital herpes, diabetes cancer, H I V, e t c…contact Dr harry mercy for herbal cure because helped my aunty with her cancer problems..whatasap number. +2348141659546 or email [email protected] gmail.com

  • I didn’t produce enough and had to switch to formula exclusively. I just dried up. I was literally formula shamed. It’s a thing and it’s awful.

  • Great and informative video! Also, I love the fact that you never once linked breastfeeding to soley mothers! #guysgalsandnonbinarypals

  • I tried so hard to breastfeed my baby, I couldn’t do it. I pumped every 60 minutes, I took the teas, I ate the oatmeal, I took the vitamins and I even went so far as to get medication from my midwife whose off-label side effect would cause breast milk. I was warned to only take it for a short time, I ignored what they recommended my dosage should be and I took 5 times the amount for 4 weeks and STILL I couldn’t make more than maybe 4 tablespoons a day.
    It made me unbelieveably sad, I felt like I let my child down, it made me feel like I was inadequate as a woman. Breast Milk is such a hot button issue for some people, for some they feel like they shouldn’t have to, for others they try so hard and know its so important but simply can’t.

  • Pretty much everyone in my family was fed with formula, we are all fine, healthy and beautiful, we all went to University also. <3

  • I breastfed and formula fed my son and he turned out wonderful. He is very intelligent and smart at just 5 years old. Doesn’t matter which method the baby will be fine.

  • MY HERPES JOURNEY 
    I was diagnosed of Genital Herpes 2011, I thought it was the end for me that I was going to live with it all my life, I began to make my own research on how I could get an alternative cure because I believe so much there could be a cure somewhere. I was tired of the drugs given to me by my medical doctor. One faithful day I came across a post of a lady, she said she was cured of her 4 years Genital Herpes by this doctor Hassan, I contacted him and he told me things I needed to do to also be cured, I ordered the herbal medicine and was delivered to me through the  DHL, after  a couple of weeks of drinking the herbs, I began to notice some changes and deep down inside I said to myself I am cured, as soon as I completed the dosage, i went for a test a week after, and I got the shocking news of my life when I received a call from the hospital that i’m now negative to the herpes virus, I never used herbal medicine before and I can now recommend this doctor Hassan to anyone Having Herpes or other transmitted infections that is reading my testimony today to contact him for your own testimony. You have no idea what this means to me and my family, I’m so grateful DR. HASSAN
      contact him via Email: [email protected] gmail.com
      Call/ WhatsApp +2349032582239

  • Not mentioned is the diet of the mother, if she’s deficient or loaded with toxins, it’s all passed on. I read recently that in some areas human milk wouldn’t meet quality standards, partly because of fertilizer, insecticide, drugs (traces now found in tap water) and heavy metals found in it.

  • you know that all babies should be breast fed because babies that are breast fed are much more healthier and don’t suffer from childhood illnesses but what you said about parents not producing enough milk is true but that does not make a excuse not to breast feed. so if you are a healthy parent to give your baby the correct amount of breast milk then breast feeding is an option

  • In 2008, when our boy was born, the mantra was more like “breastfeed or die!” I did my own homework and decided the evidence was flimsy. But that was after we’d been through the severe trauma in order to get breastfeeding working, lest we become evildoers of formula. So much pain and suffering for parents and babies trying to force breastfeeding when it’s not working. It’s so great that the truth is coming out. If you can breastfeed, great. If you can’t, don’t worry about it.

  • Thank you for using the word ‘parent’ instead of simply ‘mother’. Not only mothers feed the baby, and not everyone who lactates and nurses may identify as a woman. A small detail, but appreciated.

  • Thank you so much for this! The ‘breast is best’ was pushed so much when I was pregnant that I felt so much shame and guilt that I couldn’t produce after birth. I already felt like a bad mom because I already couldn’t provide the best for my child. Thank you so much

  • Yes!!! So many women are shamed for not wanting to breast feed or feel guilty for not being able to! It’s also really hard for moms going back to work, depending on their jobs, to keep a regular pumping schedule! The shame has to end!

  • If only you would have made this two years ago it would have helped me so much. Thank you! I failed to breastfeed my baby because of reason (really, really big, health-related reasons) and I felt like I had failed as a mother and had ruined my baby’s life. It was a really hard period of my life and I had felt so much better if someone would just have told me formula is fine. Today my child is a healthy, happy toddler and I love him more than anything. Thank you again! You have no idea how much this video means to me.

  • Formula: The science is in! Formula is better!
    Whoops turns out that was a lie brought on by capitalism.
    Formula: No really this time! The science is in! Formula is better!
    Whoops turns out they were trying to starve African babies to make a buck…
    Yeah sorry no. The only place “formula is better” comes from is desire to sell a product no one needs.
    Fool me seven times, shame on you. Fool me eight or more times, shame on me.

  • Formula is fine if breastfeeding isn’t working out for whatever reason but most research I have seen suggests that only 2 to 4 percent of women can’t make adequate milk.

  • It is INSANE how much mothers tear each other down on the internet. Your not a “real” mother if you don’t breastfeed, if you don’t have a vaginal birth, if you used any sort of pain blockers, etc. I was doing research on C-sections about a year ago for something completely unrelated and found a blog written by a mother who had to have one. She wanted a natural birth, but there was a medical complication and she had to have a C-section to save her life as well as her baby. PEOPLE WERE LEGIT TELLING HER THAT SHE SHOULDN’T CALL HERSELF A REAL MOTHER OR A GOOD MOTHER, because she “put her own convenience and comfort ahead of her baby’s needs”, right there in the comments. Saying that she didn’t “really” give birth. It was DISGUSTING. Every birth is different, and every baby is different. There are some horrible stories out there, but for the vast majority of the time, EVERY mother does what’s best for her baby and her circumstances. Full stop. Trust that Mommy has her baby’s interest at heart unless you 100% have reason to suspect otherwise, and stop putting your nose where it doesn’t belong.

  • I’m so happy to see this! My wife wasn’t able to breastfeed our daughter as often as we were pushed to and we had to supplement formula after our baby was 1-2 m/o. By 3 or 4 months, we had to feed her formula exclusively. My wife felt really bad about this for a while understandably, considering the societal, familial, and medical pressure to breastfeed.

    But our daughter is now almost 13 m/o and remarkably healthy. She’s 95th percentile in length (didn’t get that from her mom, that’s for sure, haha) and 60th in weight. She’s never had any health issues or concerns, is always remarked upon by, well, everybody as being really intelligent, focused, interactive, and happy. I’m admittedly a little biased 😉 but I can’t deny all the evidence that, in our daughter’s case, she’s suffered no adverse effects from drinking formula exclusively since 3-4 m/o.

    Our pediatrician told us that you can get at least most of the benefits exclusive to breastfeeding (those beneficial bacteria, etc mentioned at the end of the video) without having to breastfeed exclusively. He said even just once a day or less is fine. And so my wife breastfed when she could but we didn’t lose sleep over it.

    (Just please don’t take what I’m saying at face value. Like Hank said, ask your doctor not strangers on the internet haha. Obviously research online is super important as well, just check your sources! But I hope our experience (and that’s all it is) can be encouraging to other overwhelmed, overworked parents who just want the best for their kid.)

  • This is ridiculous have you ever even looked at the ingredients on a formula can?! The first ingredients are corn syrup and oil it’s no wonder that it causes obesity it’s like sugar poison for babies. And that’s not even considering the organic formula that have been shown to have arsenic in it

  • Body type too. I was told that it didn’t matter if I had flat nipples, it did. I had to stop nursing both my kids because my flat nips were ripping off.

  • This was great, I have been researching “how to get rid of smoking habit” for a while now, and I think this has helped. Have you heard people talk about Mackorny Smoking Escape Blueprint (do a google search )? Ive heard some decent things about it and my co-worker got great results with it.

  • nothing is better than black breast milk. even the slaveowners knew that. mammies would feed their kids!!!! nectar of the gods!!!!!

  • Another phenomenal video by Dr. Rhonda Patrick. This information is so critical for future parents to know, as it literally shapes the child’s future and quality of life. There are youtube channels which are a blessing and a benefit to our society and those that aren’t. This channel is certainly a cut above the rest. Well done and thank you! You’re a HERO. BTW, lovely hair.

  • If you enjoyed this episode, co-released with it is a preview of a special Q&A mashup that goes VERY in-depth on all of Rhonda’s perspectives on pregnancy and child development. Because this mashup is a pooling of this type of content across more than a dozen Q&A sessions, it really is a potent trove of great information! Get the free preview of this member content on the FoundMyFitness iTunes channel or at https://www.foundmyfitness.com/aliquot now.

  • Since my mome lactated a lot, she would secretly give my dad breast milk with chocolate, and after 2 years of drinking chocolate milk, my dad diabetes disappeared, (he was starting to have diabetes, and didn’t need insulin shots yet.). He stopped drinking breast milk bc he descovered her scheme xD I don’t know why people get so disgusted for human breast milk if they drink milk from a cow…. and its better milk.

  • I don’t get why colostrum wasn’t mentioned as well as the antibodies that are passed to the baby, and the fact that the vitamin D in formula is not as easily absorbed as vitamin D in breastmilk. There are actual benefits that you can’t get with formula. I don’t think that mentioning those things would have taken away from the driving point that it’s ok not to breastfeed, because it is, and formula is better if the mother can’t produce milk or is taking needed medications, etc.

    I went to a one-time intro to breastfeeding class when I was pregnant, they discussed the benefits over formula, but also emphasized that you aren’t a bad mom if you can’t breastfeed. One of the things that stuck with me I’ve repeated to people who felt guilty about using formula: “if you can breastfeed the first day, that’s great! The baby will receive the colostrum you produce and get a great start. If you can breastfeed the first week, that’s great! Your baby will benefit by having your antibodies passed to them during that time and have a great start…” She went on to praise a month, 3 months, 6 months and so on. The message was that regardless of what you can do and for how long, any of it is beneficial and you’re doing a great job. I wish more women were told the same thing. I especially needed it because at the time my husband (now ex) told me if I didn’t exclusively breastfeed then I didn’t want what was best for our baby, and threw out any sample formula I received. I was really afraid I wouldnt be able to breastfeed until I went to the class. He was a colossal douche lol

  • Thanks very much for this. Did Morton et al examine the case where the mother has no intake (no consumption of fish, no supplement) of long chain omega-3s?

  • Wow. So informative. I have a question, when I was young and dumb I got a tattoo while I was breastfeeding. I wasn’t even aware at the time of the heavy metal content in tattoo ink. Do you have any info on that you can share? Does that go into the bloodstream and then into the breast milk?

  • My mother could not breastfeed me she didn’t make enough milk. I was already a small baby, c section very mildly premature, and only weighted 5 11 pound and before she started me on formula I dropped to 5.7 pounds.

  • That’s interesting. I know in my family my grandma didn’t want to use formula because of the cost… But she just couldn’t breastfeed. It was impossible due to a condition. Which was bad because they didn’t have a lot of money and formula is $$$. So I am definitely pro helping women do it properly but just pushing one or the other with fear tactics and ignoring the mother’s reality is in itself dangerous. Imagine if my grandma had been made scared of formula! She had no other options.

  • I wasn’t breastfed and my IQ is above average guineas. I was allergic to breastmilk. My mom tried though sadly my parents found out three days later I wasn’t growing so they had to give me formula I was in the hospital for a weak having to be treated for severe allergic reactions to the breastmilk. I am very lucky to be alive today. I am very grateful for modern medicine.

  • We still don’t know way too much, but i’d say go with what worked for a few millions of years over what’s been invented less than a century ago. Also, this is kind of ignoring the whole bonding and closeness aspect of the issue, babies aren’t toys you need to occasionally feed and wash, and the modern mindset, especially of those pro formula, converts them to exactly that.

  • Formula, a heavily processed milk is fine for newborns? Next, this dude is gonna tell us that cola is safe as replacement for water.

  • Are you using “parent” instead of “mother” to refer to the milk-producing parent just in case it’s ever happened that a man fathered a child, then underwent sex-change procedures that took effect so quickly that by the time the child was born, he was now a she and could breast feed the infant? I’m an old man. I try to be tolerant, as the times now demand, but that scenario just seems wrong to me. I consider that only mothers can breast feed, not “parents.”

  • You know studies are strecthing it a little bit when they relate breast feed with SALARY, there are so many variables to track on that.

  • “Breast feeding is only free if the parents time means nothing”. Interesting perspective, I would argue that means her time’s value is even greater because she is taking it to bond with her baby. Also, it’s faster and easier to breast feed than to prepare formulas. Breast milk is on demand. The only way it’s time consuming is if she isn’t pumping so the father can feed while she sleeps or works. Seems this video is lacking a lot of nuance and research. As long as formula is made with cow milk proteins it will be harder to digest than a mother’s milk. Plus there are two stages of breast milk, which for the first 48 hours is not true milk and even more beneficial.

  • Your lungs can be very badly affected by smoking.Smoking can cause fatal diseases such as pneumonia, emphysema and lung cancer. Smoking causes 84% of deaths from lung cancer and 83% of deaths from chronic obstructive pulmonary disease. so please stop the smoking…be safe your life

  • Two of my closest friends were never told that not being able to produce enough milk was a possibility (basically their breastfeeding classes implied that if you just kept doing it, your supply would be enough), so they both went through a great deal of misery for the first couple months one of them was basically trying to breastfeed the entire time the baby was awake (and giving an ounce of formula every few hours to make sure he was getting enough calories), and the other wasn’t told by her doctor that she wasn’t producing enough until the baby was two months old turns out, when your baby isn’t hungry all the time, she also doesn’t cry all the time either.

  • Why you say “people who breastfeed other people’s babies” or “lactating person” why “person” instead of “woman”? Is it some pc thing? For me it sounds strange…

  • Pros about smoking:
    (literally nothing)

    Cons about smoking:
    1. damages your lungs
    2. may get cancer or any other diseases
    3. ruins your family
    4. ruins relationships
    5. can kill you
    in other words, it ruins your life

  • At minute mark 8.51 onward, it was expressed that people shouldn’t be told that “they have to breadfeed”. I have three breastfed children, and no one ever told me or reported that they were told, you “have to breastfeed” for any reason. I am a “breast is best” mama, as long as the mechanisms of breastfeeding for mama and baby are well functional. In addition, if for some reason my sanity and life is in observable jeopardy, then I do not have a justification to not provide nature’s best food for the youngest members of mankind. If needed though, I would turn to substitute milks that are from nature, but not from a manufacturer, if avoidable!

  • Could you address the issue of ketogenic diet in pregnancy? I know many advise against it and recommend low carb (minimum 50g) instead but where can I find any research regarding a minimum of carbs needed for healthy preganacy? There is very little on the internet yet the most common recommendarion is actually high carbs diet (200g) which I really cannot understand. Where is that recommendation coming from anyway?

  • Is Erectodom Secrets useful to last longer in bed? I have read a lot of good stuff about this popular erectile dysfunction treatment.

  • Every time Hank mentioned “parents mak(ing) milk” I snickered. Last time I checked ONLY THE MOTHERS make any milk! (I nursed our 3, 44 months total.)

  • Just wonderful, I have been researching “what to do to quit smoking” for a while now, and I think this has helped. Ever heard of Mackorny Smoking Escape Blueprint (do a google search )? Ive heard some decent things about it and my cousin got cool success with it.

  • Formula babies have to use more blood in their gut to process the artificial powder. More blood in the gut means less blood in the brain.

  • If cigarette causes cancer then why it’s even being sold in the market it should be banned by the government. The government is not banning the cigarette and the smokers will not going to leave this habbit.

  • Smoking tobacco does NOT necessarily guarantee you will get throat cancer. Prove me wrong. ��

    BTW. Catching the Covid-19 virus does not necessarily guarantee a death sentence.

  • I seriously cannot see why anyone would want to smoke cigarettes. They taste gross, clog and pollute the lungs, cause disease, take away taste of food, and furthermore to start smoking people have to literally force themselves to take it in as inhaling it first few times on burns throat a bit. Try have to force it the beginning. That I’d fukin stupid.

  • It is better not to smoke than to smoke and try hard to quit.
    Smoking may be pleasurable but it comes at a very high cost later on.
    It’s like pleasure for the moment but later pay a heavy price.

  • THANKYOU DOCTORS I HAVE SEEN POINT WHICH I WILL ASSEMBLE IN MY ADVICE WHICH I ALWAYS PROVIDE. I WE SHOULD UNITE TOGETHER AND PROHIBIT DRUG ABUSE PERMANRNTLY

  • IF WE LIVE TO BE OLD AND HAVE SMOKED ALL OUR LIVES THEN STOP ASKING US TO BEAT OUR SELVES UP ALL THE TIME BY SAYING SMOKING KILLS. SO FAR YOU HAVE HELP THE GOVERNMENT TO BAN SMOKING ALMOST EVERYWHERE YOU HAVE GIVEN THEM AN EXCUSE TO RAISE THE COST. YOU HAVE DENIED THE OLD FOLK OF THEIR ONLY LAST PLEASURE IN THEIR LIVES. JUST THINK THEY COULD BE YOUR MUM AND DAD.

  • I breastfed my daughter and had enough milk for twins. I pumped when I went back to work. When I switched her to formula I had to switch her three to four times to get one she could tolerate. If it was for the WIC program I wouldn’t have been able to afford it at all.

  • It’s better do die the hard way on a early age because of nicotine related diseases then just to sleep at a old age and don’t anymore wake up

  • I’m here to vent… you pig smokers if you want to smoke that’s fine.. but do not do it near me.. I will shove that shit up your ass… it’s so annoying.. you all look like shit.. sick looking women.. wrinkles and leather skin.. please stop smoking near entrances to establishments there are laws for this… and you all stink like shit.. do what you want but I run from you stinky people!!!

  • The Bible never directly mentions smoking. There are principles, however, that definitely apply to smoking. First, the Bible commands us not to allow our bodies to become “mastered” by anything. “Everything is permissible for me—but not everything is beneficial. Everything is permissible for me—but I will not be mastered by anything” (1 Corinthians 6:12). Smoking is undeniably strongly addictive. Later in the same passage we are told, “Do you not know that your body is a temple of the Holy Spirit, who is in you, whom you have received from God? You are not your own; you were bought at a price. Therefore honor God with your body” (1 Corinthians 6:19-20). Smoking is undoubtedly very bad for your health. Smoking has been proven to damage the lungs and the heart.

    Can smoking be considered “beneficial” (1 Corinthians 6:12)? Can it be said that smoking is truly honoring God with your body (1 Corinthians 6:20)? Can a person honestly smoke “for the glory of God” (1 Corinthians 10:31)? We believe that the answer to these three questions is a resounding “no.” As a result, we believe that smoking is a sin and therefore should not be practiced by followers of Jesus Christ.

    Some argue against this view by pointing to the fact that many people eat unhealthy foods, which can be just as addicting and just as bad for the body. As an example, many people are so helplessly addicted to caffeine that they cannot function without their first cup of coffee in the morning. While this is true, how does that make smoking right? It is our contention that Christians should avoid gluttony and excessively unhealthy eating. Yes, Christians are often hypocritical by condemning one sin and condoning another, but, again, this does not make smoking honoring to God.

    Another argument against this view of smoking is that many godly men have been smokers, such as the famous British preacher C.H. Spurgeon, who was known to smoke cigars. Again, we do not believe this argument holds any weight. We believe Spurgeon was wrong for smoking. Was he otherwise a godly man and fantastic teacher of God’s Word? Absolutely! Does that make all of his actions and habits honoring to God? No.

    In stating that smoking is a sin, we are not stating that all smokers are unsaved. There are many true believers in Jesus Christ who smoke. Smoking does not prevent a person from being saved. Nor does it cause a person to lose salvation. Smoking is no less forgivable than any other sin, whether for a person becoming a Christian or a Christian confessing his/her sin to God (1 John 1:9). At the same time, we firmly believe that smoking is a sin that should be forsaken and, with God’s help, overcome.

  • I have taken some native remedies and I am trying with all my might to quit, im24 and been smoking since like 12 or 13, been lucky all this time and think I should quit trying my luck

  • I am gonna make the longest comment ever bbbbbbbbbbbbbbbbbbbbbbbbbbbbgbbbbbbbbghhhhjjjjjhhuioopppppbbbbbfghdsaeryuikjhgghbbbbbbbbbbbbbbbbbhjjnbhhhhhhhhhhhhhhhgghujjjjhhgpllpkouujjjmmkkiuuhhsksikekpolokekekelikemeikelikekkdkekdkeeieieieiekikddkekmcmmdkme dejeieikeekemekkskmwkwkwmsksowololppppppowowowoowowwowowowowoowowwoowowowowowowowowkk.lollooloolllolowwpopopopoooopopoppwwkwklwoelellolxdkskkemekekekekwkkwkwkwkwkwkkwkwksosowwwsseerttitkfkfmvmmvmffkrkrkeiieoeoeieieikekekkekeieieiieieieieieikkskswkkkllolllliikkjkjjhhhyffddfgghhiikkllollollllllllkzzkzoizzizozoozoizizzizizizzaoaiaialaallwlwowkwwkkwiwiwwiwiwiwiwisiisiwiwiwiwiwiaiiikiiiooowwwwowwieieiwiwowiwoowiiihswhwuyqyqyqyqhahahahahajjahhnnmmmnanjjjuiiikkklikwerririririirkrjrkjjiisiswijjwkskklskskeskkakkklllloookiiiujjjkkyueihwubwyvwtwfeyhekeiwbeuwhueheheue(hehssnanajsjanajan)judnudenusnsisnsiheusnebsbajs sisnusjansindixksojanAPOlOloaopapwoskiswewqamnnbmnmmnbvczxzxxccmmnbbvcmnnbmnnmnmnmnnbhc6dvcygeeiieieuwuwuwauauuuuuujuuuiuujjjiiuuyycxssaaryollopppppppopopppoooaowowoaaosaoaoao ok maybe this isn’t the longest comment what a waste of time������

  • And there is one more thing to throw in the breast is best motto: jaw growth.
    The mother’s nipple has evolved to guide the growth of the baby’s craniofacial complex through muscle use, which is a part of Wolff’s law (stating that bone grows in the direction of the forces applied to it), and artificial nipples are not accurate substitutions for human nipples because of their differences in liquid delivery. Babies use a combination of muscles, like the buccinators, labia etc. to draw out the milk, but as the mechanics of delivery change, so does the muscle usage in the baby. Through habit, the baby will continue to use an inoptimal swallowing pattern that would influence the growth of their jaws badly, like not creating enough space in the jaws to house the teeth, causing crowding later in life.
    Also as the baby grows up, continued use of the bottle instead of weaning the baby to masticating food will fail to give the baby stimuli for mature swallowing patterns with the tongue and growth of the masseter muscles, which would fail to support the maxilla and mandible. Again, Wolff’s law states that forces influence bone growth, and the force of gravity is always present; it will pull the maxilla and mandibble down and crowd the teeth more, as the tongue and masseters fail to support the jaws.
    As the baby grows up, the tongue and masseters support the jaws to grow horizontally, forwards and outwards, so the jaws do not obstruct the airway as well as to encourage nasal breathing. At this point, there’s more focus on the respiratory system.
    If you’d like to know more, there’s the books 6′ Tiger 3′ Cage, Jaws: The Hidden Epidemic, The Oxygen Advantage (this book tis in the respiratory aspects) and a whole YouTube channel called Orthotropics, dedicated to the titular topic, which is branch of orthodontics that addresses growth of the face instead of just the teeth. I find the knowledge provided to be very important for parents, as it addresses issues that have undergone centuries of scientific disinterest but are now found to play a major role in the growth of a human body (the concept of orthotropics was founded in the late 20th century).

  • When my mom started going back to work, I basically had to be formula fed the rest of the time. It didn’t help that I liked feeding from a bottle better than mom’s breast, even though Apparently I liked the natural taste better….I just wanted it in a bottle, and she couldn’t pump while she was working
    I believe the aversion was because I was born with autism, and touching people even at that early age made me feel uncomfortable. Even now, I hate kissing, and anything to do with my mouth touching anything on another person’s body.

  • Please eat hot clean food and protect yourself everyone stay strong Law of Nature is cruel we are most evolved creature of this planet and those parasite are no match for us if we use our high intelligence the right way and avoid risk. (I’m still lied to myself from overwhelming fear)

  • Thank god he is okay. I really couldn’t stomach watching the end of that video without any resolution.

    So young and has his whole life ahead of him

  • God bless Dr. Umoru for his marvelous work in my life, I was diagnosed since 2014 and I was taking my medications but I wasn’t satisfied I needed to get Herpes out of my body system, I searched about some possible cure for Herpes. I saw a comment about Dr. Umoru of how he cured someone from herpes with his effective herbal product. I contacted him and he guided me. I asked him for solutions to my problem and he sent me a medication which I took for two weeks. I took the medications as he prescribed and I was surprised after going for test my result came out negative. You can also get help on any problem you are Suffering from such as.
    HPV
    Cancer
    Fibroid
    HIV and AIDS
    Sickle cell
    Warts
    Diabetes e.t.c
    Contact the great doctor via email {[email protected] com} or WhatsApp/call +2348165436638.

  • Will a normal parasite cleanse (Cloves, Woodworm, Black Walnut) along with the other remedies to assist get rid of parasites outside of the GI tract like the muscles, neck, and head?

    Also is there a special test to see parasites within the brain or can an MRI 100% detect any parasites within the head/brain?

  • Diabetes in babies is not prevented by breastfeeding, it’s the ridiculously high amounts of sugar in formula. It causes predisposition for obesity. How on earth do people feed their babies some powder that they don’t even know what it has or how it is made. People are wired to trust their doctors, nestle and other know this and abuse this to have them recomend formula for a kickback.

  • Poor little boy I’m crying ���������������������������������������������������������������������������������������� God pls heal him

  • “the parasite has taken my dreams ” your meat boy it took your meat, you are all made of meat material not dreams no spirits, that is information like text, image, sounds, lies, fantasies, dreams, fiction. the “soul” is just persistet information the more persistent fictional/stupid it is, the more stupid/sick you are, the more parasites you atract. Parasites like people with lots of stupid artificial soul(from screens) or no soul at all, whatever makes your meat tender. IT creates a culture that worships the artificial ”soul” like religion, school, video games etc.Society has spread the “artificial/soul/dream” culture into every aspect of activity, you get no job with no ”soul” you cannot reproduce. IT created an inevrse eugenics program toward degradation, aided by acepted social crimes.

  • Concerning James why don’t parents demand a second opinion? This request saved my sons life! I was not leaving until something was done, also the second Dr will be in competition with the first and will do everything to outshine the other. My son ended up spending ten days in an oxygen tent and if I went home, he would of died.

  • Symptoms: Headache, vomiting, screaming from headache, talking gibberish, altered mental state, seizures, not improving.
    Doctor: Go home.